PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family S1Fa-like
Protein Properties Length: 68aa    MW: 7300.75 Da    PI: 10.6628
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014972genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA124.92.6e-39367670
         S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                  ea+G+nPGlivllvvggll+ fl gny+ly+yaqk+lPPrkkkPvskkklk+eklkqGv +PGe
  DCAR_014972  3 SEAQGFNPGLIVLLVVGGLLFAFLGGNYALYTYAQKSLPPRKKKPVSKKKLKKEKLKQGVIPPGE 67
                 69**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046895.8E-36367IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MDSEAQGFNP GLIVLLVVGG LLFAFLGGNY ALYTYAQKSL PPRKKKPVSK KKLKKEKLKQ  60
GVIPPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.12e-27DNA-binding protein S1FA1
SwissprotQ423371e-13S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA33e-27W9SCA3_9R
STRINGSolyc09g007500.2.12e-15(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31742249